General Information

  • ID:  hor000183
  • Uniprot ID:  P81033
  • Protein name:  CHH precursor-related peptide
  • Gene name:  NA
  • Organism:  Cancer pagurus (Rock crab)
  • Family:  Arthropod CHH/MIH/GIH/VIH hormone family
  • Source:  Animal
  • Expression:  Produced by the medulla terminalis X-organ in the eyestalks and transported to the sinus gland where it is stored and released.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Cancer (genus), Cancridae (family), Cancroidea (superfamily), Heterotremata, Eubrachyura, Brachyura (infraorder), Pleocyemata (suborder), Decapoda (order), Eucarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  RSAQGMGKMERLLASYRGALEPSTPLGDLSGSLGHPVE
  • Length:  38(1-38)
  • Propeptide:  RSAQGMGKMERLLASYRGALEPSTPLGDLSGSLGHPVE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P81033-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P81033-F1.pdbhor000183_AF2.pdbhor000183_ESM.pdb

Physical Information

Mass: 462964 Formula: C169H279N51O55S2
Absent amino acids: CFINW Common amino acids: GL
pI: 7.54 Basic residues: 5
Polar residues: 13 Hydrophobic residues: 10
Hydrophobicity: -39.74 Boman Index: -6004
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 77.11
Instability Index: 3317.37 Extinction Coefficient cystines: 1490
Absorbance 280nm: 40.27

Literature

  • PubMed ID:  9809792
  • Title:  Amino Acid Sequences of Both Isoforms of Crustacean Hyperglycemic Hormone (CHH) and Corresponding Precursor-Related Peptide in Cancer Pagurus